Atlas Antibodies Anti-MTCH2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human MTCH2 (mitochondrial carrier 2). Affinity purified using PrEST antigen. Suitable for immunohistochemistry and related applications. Supplied in PBS with 40% glycerol and 0.02% sodium azide preservative.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTCH2 Antibody
Overview
Polyclonal antibody against Human MTCH2 (mitochondrial carrier 2).
Recommended for immunohistochemistry and related applications.
Product Description
- Type: Polyclonal Antibody
- Target Protein: Mitochondrial carrier 2
- Target Gene: MTCH2
- Alternative Gene Name: SLC25A50
- Host: Rabbit
- Isotype: IgG
- Clonality: Polyclonal
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000111714 | 94% |
| Rat | ENSRNOG00000058658 | 88% |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.