
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTCH2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human MTCH2 (mitochondrial carrier 2). Affinity purified using PrEST antigen. Suitable for immunohistochemistry and related applications. Supplied in PBS with 40% glycerol and 0.02% sodium azide preservative.
- 카탈로그번호
- HPA038390-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038390-100 Anti-MTCH2 Antibody, mitochondrial carrier 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038390-25 Anti-MTCH2 Antibody, mitochondrial carrier 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTCH2 Antibody
Anti-MTCH2 Antibody
Overview
Polyclonal antibody against Human MTCH2 (mitochondrial carrier 2).
Recommended for immunohistochemistry and related applications.
Product Description
- Type: Polyclonal Antibody
- Target Protein: Mitochondrial carrier 2
- Target Gene: MTCH2
- Alternative Gene Name: SLC25A50
- Host: Rabbit
- Isotype: IgG
- Clonality: Polyclonal
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000111714 | 94% |
| Rat | ENSRNOG00000058658 | 88% |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



