AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MTAP Antibody
상품 한눈에 보기
Human MTAP 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 보존성과 신뢰성 있는 검출 성능을 제공합니다.
- 카탈로그번호
- HPA046915-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA046915-100 Anti-MTAP Antibody, methylthioadenosine phosphorylase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046915-25 Anti-MTAP Antibody, methylthioadenosine phosphorylase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MTAP Antibody
Anti-MTAP Antibody
Target Protein: methylthioadenosine phosphorylase
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human MTAP (methylthioadenosine phosphorylase).
Alternative gene names: c86fus, MSAP
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
IDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFR
Species Reactivity
- Verified Species: Human
- Interspecies Homology:
- Rat ENSRNOG00000006615 (89%)
- Mouse ENSMUSG00000062937 (89%)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.