
Atlas Antibodies Anti-MTAP Antibody
상품 한눈에 보기
Human MTAP 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 보존성과 신뢰성 있는 검출 성능을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MTAP Antibody
Target Protein: methylthioadenosine phosphorylase
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human MTAP (methylthioadenosine phosphorylase).
Alternative gene names: c86fus, MSAP
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
IDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFR
Species Reactivity
- Verified Species: Human
- Interspecies Homology:
- Rat ENSRNOG00000006615 (89%)
- Mouse ENSMUSG00000062937 (89%)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
