Atlas Antibodies Anti-MSTO1 Antibody

상품 한눈에 보기

Human MSTO1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 미토콘드리아 분포 및 형태 조절 연구에 활용 가능합니다.

카탈로그번호: HPA005914-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005914-100 Anti-MSTO1 Antibody, misato 1, mitochondrial distribution and morphology regulator 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005914-25 Anti-MSTO1 Antibody, misato 1, mitochondrial distribution and morphology regulator 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MSTO1 Antibody

Anti-MSTO1 Antibody

Target: misato 1, mitochondrial distribution and morphology regulator

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody against Human MSTO1.

Alternative Gene Names

FLJ10504, LST005, misato, MST

Open Datasheet

Target Information

항목	내용
Target Protein	misato 1, mitochondrial distribution and morphology regulator
Target Gene	MSTO1
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000020357 (70%), Mouse ENSMUSG00000068922 (64%)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQ