
Atlas Antibodies Anti-MSTO1 Antibody
Human MSTO1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. 미토콘드리아 분포 및 형태 조절 연구에 활용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MSTO1 Antibody
Target: misato 1, mitochondrial distribution and morphology regulator
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human MSTO1.
Alternative Gene Names
FLJ10504, LST005, misato, MST
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | misato 1, mitochondrial distribution and morphology regulator |
| Target Gene | MSTO1 |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000020357 (70%), Mouse ENSMUSG00000068922 (64%) |
Antigen Information
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MSX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MSTO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MSTO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MT-CO2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MT-CO1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|