Atlas Antibodies Anti-MT-CO2 Antibody

상품 한눈에 보기

인간 MT-CO2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립 항체 검증을 통해 단백질 발현을 확인. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증되어 미토콘드리아 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054758-100 Anti-MT-CO2 Antibody, mitochondrially encoded cytochrome c oxidase II 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054758-25 Anti-MT-CO2 Antibody, mitochondrially encoded cytochrome c oxidase II 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrially encoded cytochrome c oxidase II
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in Western blot by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against Human MT-CO2

CO2, COX2, MTCO2

항목	내용
Target Protein	mitochondrially encoded cytochrome c oxidase II
Target Gene	MT-CO2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	TDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEIGPVFT
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000030371 (71%), Mouse ENSMUSG00000064354 (71%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand