
Atlas Antibodies Anti-MRPS34 Antibody
상품 한눈에 보기
Human MRPS34 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown으로 유전적 검증 완료. Human, Mouse, Rat에 반응하며, PrEST 항원을 이용해 친화 정제되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPS34 Antibody
Target: mitochondrial ribosomal protein S34
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, genetically validated by siRNA knockdown)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human MRPS34
Alternative Gene Names
MGC2616, MRP-S12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S34 |
| Target Gene | MRPS34 |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000038880 (82%), Rat ENSRNOG00000015479 (80%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Sequence | PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPS36 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS34 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.