AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS34 Antibody
상품 한눈에 보기
Human MRPS34 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown으로 유전적 검증 완료. Human, Mouse, Rat에 반응하며, PrEST 항원을 이용해 친화 정제되었습니다.
- 카탈로그번호
- HPA042112-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042112-100 Anti-MRPS34 Antibody, mitochondrial ribosomal protein S34 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042112-25 Anti-MRPS34 Antibody, mitochondrial ribosomal protein S34 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS34 Antibody
Anti-MRPS34 Antibody
Target: mitochondrial ribosomal protein S34
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, genetically validated by siRNA knockdown)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human MRPS34
Alternative Gene Names
MGC2616, MRP-S12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S34 |
| Target Gene | MRPS34 |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000038880 (82%), Rat ENSRNOG00000015479 (80%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Sequence | PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.