CacheBy
Atlas Antibodies Anti-MRPS36 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS36 Antibody

상품 한눈에 보기

Human MRPS36 단백질을 타겟으로 한 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Mouse, Rat과도 높은 서열 유사성을 가집니다.

카탈로그번호
HPA035802-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035802-100 Anti-MRPS36 Antibody, mitochondrial ribosomal protein S36 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035802-25 Anti-MRPS36 Antibody, mitochondrial ribosomal protein S36 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS36 Antibody

Anti-MRPS36 Antibody

Target: mitochondrial ribosomal protein S36 (MRPS36)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MRPS36.


Alternative Gene Names

  • DC47
  • MRP-S36

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein S36
Target Gene MRPS36
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000061474 (89%), Rat ENSRNOG00000061213 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.