CacheBy
Atlas Antibodies Anti-MRPS33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS33 Antibody

상품 한눈에 보기

Human MRPS33 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 연구용 애플리케이션에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 대한 반응성 검증 완료.

카탈로그번호
HPA030425-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030425-100 Anti-MRPS33 Antibody, mitochondrial ribosomal protein S33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030425-25 Anti-MRPS33 Antibody, mitochondrial ribosomal protein S33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS33 Antibody

Anti-MRPS33 Antibody

Target Information

  • Target Protein: Mitochondrial ribosomal protein S33
  • Target Gene: MRPS33
  • Alternative Gene Names: CGI-139

면역조직화학(IHC) 등 다양한 연구용 애플리케이션에 적합합니다.

Product Description

Polyclonal Antibody against Human MRPS33

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000026528 (83%)
  • Mouse ENSMUSG00000029918 (82%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 애플리케이션에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.