
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS18B Antibody
상품 한눈에 보기
Human MRPS18B 단백질을 인식하는 Rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증되어 다양한 연구에 활용 가능합니다.
- 카탈로그번호
- HPA043485-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043485-100 Anti-MRPS18B Antibody, mitochondrial ribosomal protein S18B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043485-25 Anti-MRPS18B Antibody, mitochondrial ribosomal protein S18B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS18B Antibody
Anti-MRPS18B Antibody
Target: mitochondrial ribosomal protein S18B
Type: Polyclonal Antibody against Human MRPS18B
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against the human MRPS18B protein.
Validated for multiple applications with high specificity and reproducibility.
Alternative Gene Names
C6orf14, HSPC183, MRPS18-2, PTD017
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S18B |
| Target Gene | MRPS18B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024436 (82%), Rat ENSRNOG00000000804 (80%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



