Atlas Antibodies Anti-MRPS2 Antibody

상품 한눈에 보기

Human MRPS2 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도 IgG 형태입니다. 인체 반응성이 검증되어 있으며, 40% glycerol 기반 PBS buffer에 보존됩니다.

카탈로그번호: HPA057261-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057261-100 Anti-MRPS2 Antibody, mitochondrial ribosomal protein S2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057261-25 Anti-MRPS2 Antibody, mitochondrial ribosomal protein S2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MRPS2 Antibody

Anti-MRPS2 Antibody

Target Information

Target Protein: Mitochondrial ribosomal protein S2
Target Gene: MRPS2
Alternative Gene Name: CGI-91

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody against human MRPS2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000035772	72%
Rat	ENSRNOG00000010164	70%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS	Material Safety Data Sheet