
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS11 Antibody
상품 한눈에 보기
인간 MRPS11 단백질을 인식하는 폴리클로날 항체. IHC 및 WB 검증 완료. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용한 친화정제 제품. 미토콘드리아 리보솜 단백질 연구에 적합.
- 카탈로그번호
- HPA050345-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050345-100 Anti-MRPS11 Antibody, mitochondrial ribosomal protein S11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050345-25 Anti-MRPS11 Antibody, mitochondrial ribosomal protein S11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS11 Antibody
Anti-MRPS11 Antibody
Target: mitochondrial ribosomal protein S11 (MRPS11)
Type: Polyclonal Antibody against Human MRPS11
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human MRPS11 (mitochondrial ribosomal protein S11).
Alternative Gene Names
FLJ22512, FLJ23406, HCC-2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S11 |
| Target Gene | MRPS11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000030611 (86%), Rat ENSRNOG00000018531 (86%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 설명 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



