
Atlas Antibodies Anti-MRPS11 Antibody
상품 한눈에 보기
인간 MRPS11 단백질을 인식하는 폴리클로날 항체. IHC 및 WB 검증 완료. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용한 친화정제 제품. 미토콘드리아 리보솜 단백질 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPS11 Antibody
Target: mitochondrial ribosomal protein S11 (MRPS11)
Type: Polyclonal Antibody against Human MRPS11
Recommended Applications
- IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human MRPS11 (mitochondrial ribosomal protein S11).
Alternative Gene Names
FLJ22512, FLJ23406, HCC-2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S11 |
| Target Gene | MRPS11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNG |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000030611 (86%), Rat ENSRNOG00000018531 (86%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 설명 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPS12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL58 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.