CacheBy
Atlas Antibodies Anti-MRPL58 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL58 Antibody

상품 한눈에 보기

Human MRPL58 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 40% glycerol/PBS buffer에 보존됩니다. Human 반응성 검증 완료.

카탈로그번호
HPA003634-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003634-100 Anti-MRPL58 Antibody, mitochondrial ribosomal protein L58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003634-25 Anti-MRPL58 Antibody, mitochondrial ribosomal protein L58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL58 Antibody

Anti-MRPL58 Antibody

Target: Mitochondrial ribosomal protein L58
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human MRPL58.


Alternative Gene Names

  • DS-1
  • ICT1

Open Datasheet


Target Information

항목 내용
Target Protein Mitochondrial ribosomal protein L58
Target Gene MRPL58
Verified Species Reactivity Human
Interspecies Identity Rat (88%), Mouse (85%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.