
Atlas Antibodies Anti-MRPS10 Antibody
상품 한눈에 보기
Human MRPS10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 추천됩니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증되었습니다. 미토콘드리아 리보솜 단백질 연구에 적합합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPS10 Antibody
mitochondrial ribosomal protein S10
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, independent antibody validation)
Validation of protein expression in WB
Independent antibodies targeting different epitopes were used to validate protein expression.
Product Description
Polyclonal antibody against Human MRPS10.
Alternative Gene Names
- FLJ10567
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S10 |
| Target Gene | MRPS10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000034729 (61%), Rat ENSRNOG00000022609 (56%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPS10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL55 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.