AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS10 Antibody
상품 한눈에 보기
Human MRPS10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 추천됩니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증되었습니다. 미토콘드리아 리보솜 단백질 연구에 적합합니다.
- 카탈로그번호
- HPA029134-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029134-100 Anti-MRPS10 Antibody, mitochondrial ribosomal protein S10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029134-25 Anti-MRPS10 Antibody, mitochondrial ribosomal protein S10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS10 Antibody
Anti-MRPS10 Antibody
mitochondrial ribosomal protein S10
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, independent antibody validation)
Validation of protein expression in WB
Independent antibodies targeting different epitopes were used to validate protein expression.
Product Description
Polyclonal antibody against Human MRPS10.
Alternative Gene Names
- FLJ10567
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein S10 |
| Target Gene | MRPS10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000034729 (61%), Rat ENSRNOG00000022609 (56%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.