CacheBy
Atlas Antibodies Anti-MRPL57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL57 Antibody

상품 한눈에 보기

Human MRPL57 단백질을 표적으로 하는 고품질 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원으로 Affinity 정제된 제품으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA039779-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039779-100 Anti-MRPL57 Antibody, mitochondrial ribosomal protein L57 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039779-25 Anti-MRPL57 Antibody, mitochondrial ribosomal protein L57 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL57 Antibody

Anti-MRPL57 Antibody

Target: Mitochondrial ribosomal protein L57
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Suitable for protein detection in denatured samples.

Product Description

Polyclonal antibody against Human MRPL57.


Alternative Gene Names

  • MRP63

Target Information

항목 내용
Target Protein Mitochondrial ribosomal protein L57
Target Gene MRPL57
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000010855 (81%), Mouse ENSMUSG00000021967 (79%)

Antigen Sequence:
RFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.