
Atlas Antibodies Anti-ARHGEF11 Antibody
상품 한눈에 보기
인간 ARHGEF11 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. GTRAP48, PDZ-RHOGEF 등 대체 유전자명과 교차 반응성 정보 포함. 프레스티지 친화 정제 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARHGEF11 Antibody
Rho guanine nucleotide exchange factor (GEF) 11
Recommended Applications
- IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant expression validation): Validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ARHGEF11
Alternative Gene Names
GTRAP48, KIAA0380, PDZ-RHOGEF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rho guanine nucleotide exchange factor (GEF) 11 |
| Target Gene | ARHGEF11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000041977 | 90% |
| Rat | ENSRNOG00000015026 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.