
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ARHGEF11 Antibody
상품 한눈에 보기
인간 ARHGEF11 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. GTRAP48, PDZ-RHOGEF 등 대체 유전자명과 교차 반응성 정보 포함. 프레스티지 친화 정제 방식으로 높은 특이성과 재현성 제공.
- 카탈로그번호
- HPA014658-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA014658-100 Anti-ARHGEF11 Antibody, Rho guanine nucleotide exchange factor (GEF) 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014658-25 Anti-ARHGEF11 Antibody, Rho guanine nucleotide exchange factor (GEF) 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ARHGEF11 Antibody
Anti-ARHGEF11 Antibody
Rho guanine nucleotide exchange factor (GEF) 11
Recommended Applications
- IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant expression validation): Validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ARHGEF11
Alternative Gene Names
GTRAP48, KIAA0380, PDZ-RHOGEF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rho guanine nucleotide exchange factor (GEF) 11 |
| Target Gene | ARHGEF11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000041977 | 90% |
| Rat | ENSRNOG00000015026 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



