CacheBy
Atlas Antibodies Anti-ARHGEF11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ARHGEF11 Antibody

상품 한눈에 보기

인간 ARHGEF11 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. GTRAP48, PDZ-RHOGEF 등 대체 유전자명과 교차 반응성 정보 포함. 프레스티지 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA014658-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014658-100 Anti-ARHGEF11 Antibody, Rho guanine nucleotide exchange factor (GEF) 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014658-25 Anti-ARHGEF11 Antibody, Rho guanine nucleotide exchange factor (GEF) 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ARHGEF11 Antibody

Anti-ARHGEF11 Antibody

Rho guanine nucleotide exchange factor (GEF) 11


  • IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Recombinant expression validation): Validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human ARHGEF11


Alternative Gene Names

GTRAP48, KIAA0380, PDZ-RHOGEF

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Rho guanine nucleotide exchange factor (GEF) 11
Target Gene ARHGEF11
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000041977 90%
Rat ENSRNOG00000015026 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
IHC Tooltip
WB Recombinant Expression
WB Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.