
Atlas Antibodies Anti-ARHGEF11 Antibody
상품 한눈에 보기
Human ARHGEF11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. Recombinant PrEST 항원을 이용한 친화 정제. 높은 종간 서열 보존성(인간, 생쥐, 랫드). 안정한 PBS/glycerol 버퍼 구성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARHGEF11 Antibody
Rho guanine nucleotide exchange factor (GEF) 11
Recommended Applications
IHC (Independent validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ARHGEF11
Alternative Gene Names
GTRAP48, KIAA0380, PDZ-RHOGEF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rho guanine nucleotide exchange factor (GEF) 11 |
| Target Gene | ARHGEF11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000041977 (90%), Rat ENSRNOG00000015026 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDANotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF10L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGEF10L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.