Atlas Antibodies Anti-ARHGEF11 Antibody

상품 한눈에 보기

Human ARHGEF11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증에 적합. Recombinant PrEST 항원을 이용한 친화 정제. 높은 종간 서열 보존성(인간, 생쥐, 랫드). 안정한 PBS/glycerol 버퍼 구성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA012037-100 Anti-ARHGEF11 Antibody, Rho guanine nucleotide exchange factor (GEF) 11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA012037-25 Anti-ARHGEF11 Antibody, Rho guanine nucleotide exchange factor (GEF) 11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Rho guanine nucleotide exchange factor (GEF) 11

IHC (Independent validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human ARHGEF11

GTRAP48, KIAA0380, PDZ-RHOGEF

항목	내용
Target Protein	Rho guanine nucleotide exchange factor (GEF) 11
Target Gene	ARHGEF11
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000041977 (90%), Rat ENSRNOG00000015026 (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Independent Validation
WB Recombinant Expression

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.