
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-APOH Antibody
상품 한눈에 보기
인간 APOH(apolipoprotein H, beta-2-glycoprotein I)을 인식하는 폴리클로날 항체입니다. IHC, WB, ICC에 적합하며, 유전자 및 독립 항체 기반 검증을 거쳤습니다. 토끼 유래 IgG로, 프레스티 항원 친화 정제 방식으로 제조되었습니다.
- 카탈로그번호
- HPA003732-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003732-100 Anti-APOH Antibody, apolipoprotein H (beta-2-glycoprotein I) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003732-25 Anti-APOH Antibody, apolipoprotein H (beta-2-glycoprotein I) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-APOH Antibody
Anti-APOH Antibody
Target: apolipoprotein H (beta-2-glycoprotein I)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation by siRNA knockdown.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against human APOH.
Alternative Gene Names
B2G1, BG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | apolipoprotein H (beta-2-glycoprotein I) |
| Target Gene | APOH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003566 (85%), Mouse ENSMUSG00000000049 (76%) |
Antigen Sequence:
ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



