Atlas Antibodies Anti-APOH Antibody

상품 한눈에 보기

인간 APOH(apolipoprotein H, beta-2-glycoprotein I)을 인식하는 폴리클로날 항체입니다. IHC, WB, ICC에 적합하며, 유전자 및 독립 항체 기반 검증을 거쳤습니다. 토끼 유래 IgG로, 프레스티 항원 친화 정제 방식으로 제조되었습니다.

카탈로그번호: HPA003732-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003732-100 Anti-APOH Antibody, apolipoprotein H (beta-2-glycoprotein I) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003732-25 Anti-APOH Antibody, apolipoprotein H (beta-2-glycoprotein I) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-APOH Antibody

Anti-APOH Antibody

Target: apolipoprotein H (beta-2-glycoprotein I)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Independent Validation): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic Validation): Genetic validation by siRNA knockdown.
ICC: Immunocytochemistry application supported.

Product Description

Polyclonal antibody against human APOH.

Alternative Gene Names

B2G1, BG

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	apolipoprotein H (beta-2-glycoprotein I)
Target Gene	APOH
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000003566 (85%), Mouse ENSMUSG00000000049 (76%)

Antigen Sequence:
ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet