AI 생성

1 / 2

Atlas Antibodies Anti-APOH Antibody

상품 한눈에 보기

인간 APOH 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체로, IHC와 WB 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001654-100 Anti-APOH Antibody, apolipoprotein H (beta-2-glycoprotein I) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001654-25 Anti-APOH Antibody, apolipoprotein H (beta-2-glycoprotein I) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: apolipoprotein H (beta-2-glycoprotein I)

IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
ICC (Immunocytochemistry)

Polyclonal antibody against human APOH.

B2G1, BG

항목	내용
Target Protein	apolipoprotein H (beta-2-glycoprotein I)
Target Gene	APOH
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000003566 (85%), Mouse ENSMUSG00000000049 (76%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK

Enhanced Validation
IHC Independent
WB Genetic
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.