
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-APLP1 Antibody
상품 한눈에 보기
Human APLP1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Orthogonal 및 recombinant expression validation 수행. Rabbit에서 생산된 IgG 항체로 고순도 affinity purification. 다양한 조직에서 APLP1 발현 연구에 활용 가능.
- 카탈로그번호
- HPA028970-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028970-100 Anti-APLP1 Antibody, amyloid beta (A4) precursor-like protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028970-25 Anti-APLP1 Antibody, amyloid beta (A4) precursor-like protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-APLP1 Antibody
Anti-APLP1 Antibody
Target: amyloid beta (A4) precursor-like protein 1
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human APLP1
Alternative Gene Names
APLP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | amyloid beta (A4) precursor-like protein 1 |
| Target Gene | APLP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HLAQELRPQIQELLHSEHLGPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSLGAPHR |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000006651 (74%), Rat ENSRNOG00000020851 (70%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



