CacheBy
Atlas Antibodies Anti-APLF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-APLF Antibody

상품 한눈에 보기

Human APLF 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 적합합니다. Human에 대해 검증되었고, Mouse 및 Rat과 유사성이 있습니다.

카탈로그번호
HPA034642-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034642-100 Anti-APLF Antibody, aprataxin and PNKP like factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034642-25 Anti-APLF Antibody, aprataxin and PNKP like factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-APLF Antibody

Anti-APLF Antibody

Target Information

  • Protein: aprataxin and PNKP like factor
  • Gene: APLF
  • Alternative Gene Names: C2orf13, MGC47799, Xip1, ZCCHH1

면역조직화학(IHC) 등 다양한 생물학적 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human APLF

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF

Species Reactivity

  • Verified: Human
  • Interspecies Information:
    • Mouse ENSMUSG00000049409 (63%)
    • Rat ENSRNOG00000009556 (59%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.