AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AP5S1 Antibody
상품 한눈에 보기
Human AP5S1 단백질을 타깃으로 하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 대한 반응성이 검증됨.
- 카탈로그번호
- HPA048244-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048244-100 Anti-AP5S1 Antibody, adaptor-related protein complex 5, sigma 1 subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048244-25 Anti-AP5S1 Antibody, adaptor-related protein complex 5, sigma 1 subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AP5S1 Antibody
Anti-AP5S1 Antibody
Target: adaptor related protein complex 5 sigma 1 subunit (AP5S1)
Type: Polyclonal Antibody against Human AP5S1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting the human adaptor related protein complex 5 sigma 1 subunit (AP5S1).
Alternative Gene Names
- C20orf29
- FLJ11168
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adaptor related protein complex 5 sigma 1 subunit |
| Target Gene | AP5S1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000068264 (90%), Rat ENSRNOG00000021249 (90%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.