
Atlas Antibodies Anti-AP5S1 Antibody
상품 한눈에 보기
Human AP5S1 단백질을 타깃으로 하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 대한 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AP5S1 Antibody
Target: adaptor related protein complex 5 sigma 1 subunit (AP5S1)
Type: Polyclonal Antibody against Human AP5S1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting the human adaptor related protein complex 5 sigma 1 subunit (AP5S1).
Alternative Gene Names
- C20orf29
- FLJ11168
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adaptor related protein complex 5 sigma 1 subunit |
| Target Gene | AP5S1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000068264 (90%), Rat ENSRNOG00000021249 (90%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-APBA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-APAF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AP5S1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AP5M1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AP5B1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.