CacheBy
Atlas Antibodies Anti-AP5M1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AP5M1 Antibody

상품 한눈에 보기

Human AP5M1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 사용해 친화 정제되었습니다. 인간에 대해 검증되었으며 높은 종간 상동성을 보입니다.

카탈로그번호
HPA057098-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057098-100 Anti-AP5M1 Antibody, adaptor-related protein complex 5, mu 1 subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057098-25 Anti-AP5M1 Antibody, adaptor-related protein complex 5, mu 1 subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AP5M1 Antibody

Anti-AP5M1 Antibody

Target: adaptor-related protein complex 5, mu 1 subunit
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human AP5M1.

Alternative Gene Names

C14orf108, FLJ10813, mu5, MuD, MUDENG

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein adaptor-related protein complex 5, mu 1 subunit
Target Gene AP5M1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000036291 (87%), Rat ENSRNOG00000014148 (86%)

Antigen Sequence:
PLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.