Atlas Antibodies Anti-AP1S1 Antibody
상품 한눈에 보기
인간 AP1S1 단백질을 인식하는 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 정제되었습니다. 인간, 생쥐, 랫드에 모두 반응하며 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AP1S1 Antibody
Target: adaptor-related protein complex 1, sigma 1 subunit
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human AP1S1.
Alternative Gene Names
AP19, CLAPS1, EKV3, SIGMA1A, WUGSC:H_DJ0747G18.2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adaptor-related protein complex 1, sigma 1 subunit |
| Target Gene | AP1S1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000001415 (100%), Mouse ENSMUSG00000004849 (100%) |
Antigen Sequence:
KKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.