Atlas Antibodies Anti-AP1AR Antibody

상품 한눈에 보기

인간 AP1AR 단백질에 대한 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 높은 특이성을 보이며, 랫트와 마우스에도 교차 반응 가능성이 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058115-100 Anti-AP1AR Antibody, adaptor-related protein complex 1 associated regulatory protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058115-25 Anti-AP1AR Antibody, adaptor-related protein complex 1 associated regulatory protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: adaptor-related protein complex 1 associated regulatory protein
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Western Blot (WB)
Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human AP1AR

항목	내용
Target Protein	adaptor-related protein complex 1 associated regulatory protein
Target Gene	AP1AR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000024492 (94%), Mouse ENSMUSG00000074238 (90%)

Antigen Sequence:

GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand