CacheBy
Atlas Antibodies Anti-AOC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AOC3 Antibody

상품 한눈에 보기

인간 AOC3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 정량적 단백질 발현 검증에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간에 대한 반응성이 검증됨. RNA-seq 및 재조합 발현 기반 정밀 검증 완료.

카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000980-100 Anti-AOC3 Antibody, amine oxidase, copper containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000980-25 Anti-AOC3 Antibody, amine oxidase, copper containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AOC3 Antibody

Anti-AOC3 Antibody

Target: amine oxidase, copper containing 3 (AOC3)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human AOC3.


Alternative Gene Names

HPAO, VAP-1, VAP1


Target Information

항목 내용
Target Protein amine oxidase, copper containing 3
Target Gene AOC3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000019326 84%
Rat ENSRNOG00000053448 82%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.