
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AOC3 Antibody
상품 한눈에 보기
인간 AOC3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 정량적 단백질 발현 검증에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간에 대한 반응성이 검증됨. RNA-seq 및 재조합 발현 기반 정밀 검증 완료.
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000980-100 Anti-AOC3 Antibody, amine oxidase, copper containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000980-25 Anti-AOC3 Antibody, amine oxidase, copper containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AOC3 Antibody
Anti-AOC3 Antibody
Target: amine oxidase, copper containing 3 (AOC3)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human AOC3.
Alternative Gene Names
HPAO, VAP-1, VAP1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | amine oxidase, copper containing 3 |
| Target Gene | AOC3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000019326 | 84% |
| Rat | ENSRNOG00000053448 | 82% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



