Atlas Antibodies Anti-AOC3 Antibody

상품 한눈에 보기

인간 AOC3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 정량적 단백질 발현 검증에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간에 대한 반응성이 검증됨. RNA-seq 및 재조합 발현 기반 정밀 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000980-100 Anti-AOC3 Antibody, amine oxidase, copper containing 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000980-25 Anti-AOC3 Antibody, amine oxidase, copper containing 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: amine oxidase, copper containing 3 (AOC3)
Supplier: Atlas Antibodies

IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody against human AOC3.

HPAO, VAP-1, VAP1

항목	내용
Target Protein	amine oxidase, copper containing 3
Target Gene	AOC3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLI

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000019326	84%
Rat	ENSRNOG00000053448	82%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand