Atlas Antibodies Anti-AOAH Antibody

상품 한눈에 보기

Human AOAH 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. PBS/glycerol buffer에 보존되어 연구용으로 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021666-100 Anti-AOAH Antibody, acyloxyacyl hydrolase (neutrophil) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021666-25 Anti-AOAH Antibody, acyloxyacyl hydrolase (neutrophil) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against Human AOAH, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNP

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Applications	IHC, WB
Storage Conditions	Store at -20°C; avoid repeated freeze-thaw cycles
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety Information	Material Safety Data Sheet