Atlas Antibodies Anti-ANO1 Antibody

상품 한눈에 보기

Human ANO1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Rabbit에서 유래한 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었으며, RNA-seq 데이터 기반의 직교 검증이 수행되었습니다.

카탈로그번호: HPA032148-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA032148-100 Anti-ANO1 Antibody, anoctamin 1, calcium activated chloride channel 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA032148-25 Anti-ANO1 Antibody, anoctamin 1, calcium activated chloride channel 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ANO1 Antibody

Anti-ANO1 Antibody

Target: anoctamin 1, calcium activated chloride channel
Type: Polyclonal Antibody against Human ANO1

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody targeting Human ANO1 (anoctamin 1, calcium activated chloride channel).

Alternative Gene Names

DOG1, FLJ10261, ORAOV2, TAOS2, TMEM16A

Open Datasheet

Target Information

항목	내용
Target Protein	anoctamin 1, calcium activated chloride channel
Target Gene	ANO1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020865 (83%)
Mouse ENSMUSG00000031075 (83%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand