Atlas Antibodies Anti-ANO1 Antibody

상품 한눈에 보기

Human ANO1 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 Orthogonal 검증 수행. Rabbit 유래 IgG, PrEST 항원으로 정제. DOG1 등 다양한 대체 유전자명 사용. Human 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057356-100 Anti-ANO1 Antibody, anoctamin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057356-25 Anti-ANO1 Antibody, anoctamin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: anoctamin 1, calcium activated chloride channel
Validation Type: Enhanced Validation

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human ANO1

DOG1, FLJ10261, ORAOV2, TAOS2, TMEM16A

항목	내용
Target Protein	anoctamin 1, calcium activated chloride channel
Target Gene	ANO1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000031075 (83%), Rat ENSRNOG00000020865 (83%)

Antigen Sequence:
RVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand