CacheBy
Thermo Fisher Scientific PDK4 Polyclonal Antibody
원본

Thermo Fisher Scientific PDK4 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 PDK4 Polyclonal Antibody는 인간 및 랫트 반응성을 가지며 Western blot에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, 포도당 대사 조절 연구에 활용됩니다. -20°C에서 보관하며 연구용으로만 사용됩니다.

카탈로그번호
PA579800
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 05:54
Thermo Fisher Scientific PA579800 PDK4 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific PDK4 Polyclonal Antibody

Applications

Western Blot (WB)


Product Specifications

항목 내용
Species Reactivity Human, Rat
Published Species Not Applicable
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91–125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN).
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746915

Product Specific Information

  • Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

PDK4 (PDHK4), along with other PDHKs, regulates glucose metabolism by phosphorylating the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex.
Inhibition of PDHKs is viewed as a potential therapeutic treatment for type II diabetes.
This protein is located in the mitochondrial matrix and its expression is regulated by glucocorticoids, retinoic acid, and insulin.
PDK4 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, contributing to glucose metabolism regulation.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

PA5-79800_PDK4_Q16654-1_Rabbit.svg
PA5-79800_PDK4_Q16654-1_Rabbit_PDP.jpeg

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.