Thermo Fisher Scientific PDK4 Polyclonal Antibody
Thermo Fisher Scientific의 PDK4 Polyclonal Antibody는 인간 및 랫트 반응성을 가지며 Western blot에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, 포도당 대사 조절 연구에 활용됩니다. -20°C에서 보관하며 연구용으로만 사용됩니다.
- 카탈로그번호
- PA579800
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PDK4 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91–125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746915 |
Product Specific Information
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PDK4 (PDHK4), along with other PDHKs, regulates glucose metabolism by phosphorylating the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex.
Inhibition of PDHKs is viewed as a potential therapeutic treatment for type II diabetes.
This protein is located in the mitochondrial matrix and its expression is regulated by glucocorticoids, retinoic acid, and insulin.
PDK4 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, contributing to glucose metabolism regulation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.