원본
Thermo Fisher Scientific ADAM2 Polyclonal Antibody
상품 한눈에 보기
ADAM2 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도를 제공합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 07:16
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578724 ADAM2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific ADAM2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231–274aa: WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745840 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ADAM2는 ADAM (a disintegrin and metalloprotease domain) 패밀리에 속하는 막 결합 단백질로, 뱀독 디스인테그린과 구조적으로 유사합니다. 이 단백질군은 세포 간 및 세포-기질 상호작용과 관련된 다양한 생물학적 과정(수정, 근육 발달, 신경 발생 등)에 관여합니다.
ADAM2는 정자막 당단백질 복합체인 fertilin의 구성 단위로, 정자-난자 상호작용에서 중요한 역할을 합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Adenosine Deaminase Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ADAM19 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ADAM2 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Adenosine Deaminase Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.