
Thermo Fisher Scientific ADAM2 Polyclonal Antibody
ADAM2 단백질을 인식하는 Rabbit Polyclonal 항체로 Western blot에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도를 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231–274aa: WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745840 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ADAM2는 ADAM (a disintegrin and metalloprotease domain) 패밀리에 속하는 막 결합 단백질로, 뱀독 디스인테그린과 구조적으로 유사합니다. 이 단백질군은 세포 간 및 세포-기질 상호작용과 관련된 다양한 생물학적 과정(수정, 근육 발달, 신경 발생 등)에 관여합니다.
ADAM2는 정자막 당단백질 복합체인 fertilin의 구성 단위로, 정자-난자 상호작용에서 중요한 역할을 합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Adenosine Deaminase Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ADAM19 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ADAM2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ADAM2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Adenosine Deaminase Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|