Thermo Fisher Scientific SLC22A2 Polyclonal Antibody
SLC22A2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. 인간, 마우스, 랫트 반응성. WB 및 IHC에 적합. 항원 친화 크로마토그래피로 정제된 동결건조 형태로 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | - | View 1 publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524–555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747130 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Organic cation transporters (OCT) are expressed in the plasma membrane of epithelial cells from various tissues, functioning in the elimination of endogenous amines, cationic drugs, and xenobiotics.
OCTs have a 12-transmembrane-domain structure and a large extracellular hydrophilic loop.
- OCT1: Primarily expressed in the liver
- OCT2 (SLC22A2): Expressed in the kidney; mediates pH-sensitive tubular uptake of organic compounds
- OCT3: Expressed in placenta, skeletal muscle, prostate, aorta, and liver
OCT2 localizes to the basolateral and luminal membranes of kidney distal and proximal tubules. An additional splice variant, OCT2-A, also exists.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SLC22A6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC22A5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC22A2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC22A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific GLT-1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|