원본
Thermo Fisher Scientific CD41 Polyclonal Antibody
상품 한눈에 보기
CD41 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot 및 IHC에 사용 가능하며, 항원 친화 크로마토그래피로 정제되었습니다. 혈소판 응집 및 혈액응고 연구에 적합합니다.
- 카탈로그번호
- PA579527
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 04:00
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579527 CD41 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific CD41 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (IHC) | – | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | – |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677–711aa: EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746643 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CD41 (platelet glycoprotein IIb, ITGA2B)는 120 kDa α-서브유닛과 23 kDa β-서브유닛으로 구성되며, 칼슘 존재하에서 CD61과 상호작용하여 기능적 접착 단백질 수용체를 형성합니다.
혈소판 응집을 매개하여 혈액 응고에 관여하며, 손상된 혈관 부위에서 von Willebrand factor, fibrinogen, fibronectin, vitronectin 등 다양한 단백질과 결합합니다.
CD41은 주로 거핵세포-혈소판 계통에서 발현되며, 조혈 분화 초기 단계에서도 발현됩니다.
CD41 기능 이상은 Glanzmann Thrombasthenia 및 Platelet type-16 bleeding disorder와 관련이 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific CD11a Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CD49e (Integrin alpha 5) Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CD41 Polyclonal Antibody599,200원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CD49c (Integrin alpha 3) Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.