
Atlas Antibodies Anti-MROH2A Antibody
Human MROH2A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. HEATR7B1로도 알려진 MROH2A를 타겟하며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도 IgG 항체로 높은 특이성과 재현성을 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MROH2A Antibody
Target: maestro heat-like repeat family member 2A (MROH2A)
Alternative Gene Name: HEATR7B1
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Product Description
Polyclonal Antibody against Human MROH2A (maestro heat-like repeat family member 2A).
Also known as HEATR7B1.
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunohistochemistry (IHC)
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
TVLNVLHDFEERIQESEQSWQISAWRKDHPWRRETVKSALMVMYSCVASYCHPQLLLNLVDSPITAKIIHHYV
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000042182 | 92% |
| Mouse | ENSMUSG00000079429 | 89% |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Storage & Handling
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MROH7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MROH2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MROH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MROH1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|