CacheBy
Atlas Antibodies Anti-MROH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MROH1 Antibody

상품 한눈에 보기

Human MROH1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC 응용에 적합. HEATR7A/KIAA1833 대체 유전자명 사용. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤과 PBS 완충액에 보존됨.

카탈로그번호
HPA024287-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024287-100 Anti-MROH1 Antibody, maestro heat like repeat family member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024287-25 Anti-MROH1 Antibody, maestro heat like repeat family member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MROH1 Antibody

Anti-MROH1 Antibody

Target: maestro heat like repeat family member 1 (MROH1)
Supplier: Atlas Antibodies

  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human MROH1.

Alternative Gene Names

HEATR7A, KIAA1833

Open Datasheet

Target Information

항목 내용
Target Protein maestro heat like repeat family member 1
Target Gene MROH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (74%), Rat (73%)

Antigen Sequence:
PGTLPHCAVLHTLASLSVANAFGVVPFLPSVLSSLLPVLGVAKQDTVRVAFCSALQRFSEGALEYLANLDRAPDPTVRKDAFATDIFSAYDVLFHQWLQSREAKLRL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.