
Atlas Antibodies Anti-MPHOSPH10 Antibody
상품 한눈에 보기
Human MPHOSPH10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. 인간 단백질에 특이적이며 설치류와 높은 서열 유사성 보유. 안정한 PBS/glycerol 버퍼에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MPHOSPH10 Antibody
M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein)
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human MPHOSPH10.
Alternative Gene Names
CT90, MPP10, MPP10P, PPP1R106
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein) |
| Target Gene | MPHOSPH10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RLTLDHEKSKLSLAEIYEQEYIKLNQQKTAEEENPEHVEIQKMMDSLFLKLDALSNFHFIPKPPVPEIKVVSNLPAITMEEVAPVSVSDAALLA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016266 (97%), Mouse ENSMUSG00000030521 (97%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MPHOSPH10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPHOSPH8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPHOSPH10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPHOSPH10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.