Atlas Antibodies Anti-MPC1 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-MPC1 Antibody는 인간 MPC1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 orthogonal validation을 거쳤습니다. 고순도 affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA045119-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Primary Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045119-100 Anti-MPC1 Antibody, mitochondrial pyruvate carrier 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045119-25 Anti-MPC1 Antibody, mitochondrial pyruvate carrier 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MPC1 Antibody

Anti-MPC1 Antibody

mitochondrial pyruvate carrier 1

Recommended Applications

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Orthogonal Validation
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC

Product Description

Polyclonal Antibody against Human MPC1

Alternative Gene Names

BRP44L, CGI-129, dJ68L15.3

Open Datasheet

Target Information

항목	내용
Target Protein	mitochondrial pyruvate carrier 1
Target Gene	MPC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000023861 (100%), Rat ENSRNOG00000012415 (100%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand