
Atlas Antibodies Anti-MOSPD3 Antibody
상품 한눈에 보기
Human MOSPD3 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC에 적합. Recombinant expression 검증 완료. 높은 인간 특이성과 정제된 IgG 형태로 제공. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MOSPD3 Antibody
Target: motile sperm domain containing 3
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation)
- ICC (Immunocytochemistry)
Recombinant expression validation: 검증된 WB 결과는 target protein 과발현을 기반으로 수행됨.
Product Description
Polyclonal antibody against Human MOSPD3
Alternative Gene Names: CDS3, NET30
Target Protein: motile sperm domain containing 3
Target Gene: MOSPD3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001396 | 89% |
| Mouse | ENSMUSG00000037221 | 88% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MPDU1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MPEG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MOSPD3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MORN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MOV10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.