
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MOSPD3 Antibody
상품 한눈에 보기
Human MOSPD3 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC에 적합. Recombinant expression 검증 완료. 높은 인간 특이성과 정제된 IgG 형태로 제공. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.
- 카탈로그번호
- HPA048240-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048240-100 Anti-MOSPD3 Antibody, motile sperm domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048240-25 Anti-MOSPD3 Antibody, motile sperm domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MOSPD3 Antibody
Anti-MOSPD3 Antibody
Target: motile sperm domain containing 3
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation)
- ICC (Immunocytochemistry)
Recombinant expression validation: 검증된 WB 결과는 target protein 과발현을 기반으로 수행됨.
Product Description
Polyclonal antibody against Human MOSPD3
Alternative Gene Names: CDS3, NET30
Target Protein: motile sperm domain containing 3
Target Gene: MOSPD3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001396 | 89% |
| Mouse | ENSMUSG00000037221 | 88% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



