CacheBy
Atlas Antibodies Anti-MPDU1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MPDU1 Antibody

상품 한눈에 보기

Human MPDU1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Human, Mouse, Rat에 반응하며, PrEST 항원을 이용해 Affinity 정제되었습니다. 40% glycerol과 PBS buffer에 보존되어 있습니다.

카탈로그번호
HPA014845-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014845-100 Anti-MPDU1 Antibody, mannose-P-dolichol utilization defect 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014845-25 Anti-MPDU1 Antibody, mannose-P-dolichol utilization defect 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MPDU1 Antibody

Anti-MPDU1 Antibody

mannose-P-dolichol utilization defect 1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human MPDU1

Alternative Gene Names

CDGIf, Lec35, PQLC5, SL15

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mannose-P-dolichol utilization defect 1
Target Gene MPDU1
Antigen Sequence AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Verified Species Reactivity Human, Mouse, Rat
Interspecies Homology Mouse ENSMUSG00000018761 (93%), Rat ENSRNOG00000012162 (83%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.