
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MKRN2 Antibody
상품 한눈에 보기
Human MKRN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 사람, 생쥐, 랫드 반응성이 확인되었습니다. 단백질 발현 검증에 활용 가능합니다.
- 카탈로그번호
- HPA037559-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037559-100 Anti-MKRN2 Antibody, makorin ring finger protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037559-25 Anti-MKRN2 Antibody, makorin ring finger protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MKRN2 Antibody
Anti-MKRN2 Antibody
Target: makorin ring finger protein 2 (MKRN2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
단백질의 발현을 서로 다른 에피토프를 인식하는 독립 항체 간 비교를 통해 검증 - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human MKRN2
Alternative Gene Names
HSPC070, RNF62
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | makorin ring finger protein 2 |
| Target Gene | MKRN2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQ |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000000439 | 81% |
| Rat | ENSRNOG00000009176 | 79% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (보존제) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



