
Atlas Antibodies Anti-MKRN2 Antibody
상품 한눈에 보기
Human MKRN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 사람, 생쥐, 랫드 반응성이 확인되었습니다. 단백질 발현 검증에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MKRN2 Antibody
Target: makorin ring finger protein 2 (MKRN2)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
단백질의 발현을 서로 다른 에피토프를 인식하는 독립 항체 간 비교를 통해 검증 - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human MKRN2
Alternative Gene Names
HSPC070, RNF62
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | makorin ring finger protein 2 |
| Target Gene | MKRN2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQ |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000000439 | 81% |
| Rat | ENSRNOG00000009176 | 79% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (보존제) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MKS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKRN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKRN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKRN2OS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKRN2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.