CacheBy
Atlas Antibodies Anti-MKRN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MKRN2 Antibody

상품 한눈에 보기

Human MKRN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. HSPC070, RNF62 유전자 대체명 포함. PrEST 항원을 이용해 친화 정제되었으며, 인간, 마우스, 랫트 반응성 검증 완료.

카탈로그번호
HPA037560-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037560-100 Anti-MKRN2 Antibody, makorin ring finger protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037560-25 Anti-MKRN2 Antibody, makorin ring finger protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MKRN2 Antibody

Anti-MKRN2 Antibody

Target: makorin ring finger protein 2 (MKRN2)
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human MKRN2


Alternative Gene Names

  • HSPC070
  • RNF62

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein makorin ring finger protein 2
Target Gene MKRN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQ
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000000439 (81%), Rat ENSRNOG00000009176 (79%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Tooltip Independent
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.