Atlas Antibodies Anti-METTL24 Antibody

상품 한눈에 보기

인간 METTL24 단백질을 표적으로 하는 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안정적인 PBS/glycerol 완충액에 보존됩니다.

카탈로그번호: HPA037442-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037442-100 Anti-METTL24 Antibody, methyltransferase like 24 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037442-25 Anti-METTL24 Antibody, methyltransferase like 24 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-METTL24 Antibody

Anti-METTL24 Antibody

개요

Target Protein: methyltransferase like 24
Target Gene: METTL24
Alternative Gene Names: C6orf186, dJ71D21.2
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications: Immunohistochemistry (IHC)

제품 설명

Polyclonal antibody against human METTL24.
This antibody is affinity purified using the PrEST antigen as ligand and optimized for research applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AQSLDEEAWRFLRYISTTQIACNHMNTDSLATDSSPTHKPWSVCLDDRFNLAHQIRNKQCRLYSLGLGSDDTHFEVSMANNGCEV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000045555 (85%)
Rat ENSRNOG00000024221 (80%)

Buffer Information

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet

사용 시 주의사항

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

데이터시트

Open Datasheet (PDF)

제품 스펙 요약

항목	내용
Target Protein	methyltransferase like 24
Gene	METTL24
Alternative Names	C6orf186, dJ71D21.2
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Verified Reactivity	Human
Purification	Affinity purified (PrEST antigen)
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Application	IHC
Storage	Store at -20°C or as recommended