Atlas Antibodies Anti-METTL24 Antibody
인간 METTL24 단백질을 표적으로 하는 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안정적인 PBS/glycerol 완충액에 보존됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-METTL24 Antibody
개요
- Target Protein: methyltransferase like 24
- Target Gene: METTL24
- Alternative Gene Names: C6orf186, dJ71D21.2
- Host: Rabbit
- Clonality: Polyclonal
- Isotype: IgG
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
- Recommended Applications: Immunohistochemistry (IHC)
제품 설명
Polyclonal antibody against human METTL24.
This antibody is affinity purified using the PrEST antigen as ligand and optimized for research applications.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
AQSLDEEAWRFLRYISTTQIACNHMNTDSLATDSSPTHKPWSVCLDDRFNLAHQIRNKQCRLYSLGLGSDDTHFEVSMANNGCEV
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000045555 (85%)
- Rat ENSRNOG00000024221 (80%)
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
사용 시 주의사항
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
데이터시트
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Target Protein | methyltransferase like 24 |
| Gene | METTL24 |
| Alternative Names | C6orf186, dJ71D21.2 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Verified Reactivity | Human |
| Purification | Affinity purified (PrEST antigen) |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Application | IHC |
| Storage | Store at -20°C or as recommended |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-METTL26 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-METTL25 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-METTL24 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-METTL24 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-METTL22 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|