
원본
Atlas Antibodies Anti-METTL22 Antibody
상품 한눈에 보기
Human METTL22 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, glycerol/PBS buffer에 보존되어 있습니다.
- 카탈로그번호
- HPA074173-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA074173-100 Anti-METTL22 Antibody, methyltransferase like 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074173-25 Anti-METTL22 Antibody, methyltransferase like 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-METTL22 Antibody
Anti-METTL22 Antibody
Product Description
Polyclonal antibody against Human METTL22 (methyltransferase like 22).
Recommended Applications
- Immunohistochemistry (IHC)
Alternative Gene Names
- C16orf68
- FLJ12433
- MGC2654
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methyltransferase like 22 |
| Target Gene | METTL22 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVPFSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSR |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000039345 (83%)
- Rat ENSRNOG00000002714 (83%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



