Atlas Antibodies Anti-METAP1D Antibody

상품 한눈에 보기

인간 METAP1D 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 재조합 발현 검증 완료. 토끼에서 생산된 IgG 형태이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증된 고품질 연구용 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030299-100 Anti-METAP1D Antibody, methionyl aminopeptidase type 1D (mitochondrial) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030299-25 Anti-METAP1D Antibody, methionyl aminopeptidase type 1D (mitochondrial) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: methionyl aminopeptidase type 1D (mitochondrial)

IHC (Immunohistochemistry)
WB (Western Blot, recombinant expression validation using target protein overexpression)
ICC (Immunocytochemistry)

Polyclonal antibody against Human METAP1D

MAP1D, Metap1l

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA

항목	내용
Target Protein	methionyl aminopeptidase type 1D (mitochondrial)
Target Gene	METAP1D
Verified Species Reactivity	Human
Interspecies Information	Mouse (96%), Rat (93%) sequence identity

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand