
Atlas Antibodies Anti-METAP1D Antibody
상품 한눈에 보기
인간 METAP1D 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. 재조합 발현 검증 완료. 토끼에서 생산된 IgG 형태이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증된 고품질 연구용 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-METAP1D Antibody
Target: methionyl aminopeptidase type 1D (mitochondrial)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation using target protein overexpression)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human METAP1D
Alternative Gene Names
MAP1D, Metap1l
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA
Target Details
| 항목 | 내용 |
|---|---|
| Target Protein | methionyl aminopeptidase type 1D (mitochondrial) |
| Target Gene | METAP1D |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse (96%), Rat (93%) sequence identity |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
Material Safety Data Sheet (Sodium Azide)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-METAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-METRN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-METAP1D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-METAP1D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-METAP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.