Atlas Antibodies Anti-METAP1D Antibody

상품 한눈에 보기

인간 METAP1D 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 발현 검증을 거쳤으며, 고순도의 Affinity 정제 항체입니다. Rabbit 호스트 기반으로 안정적인 반응성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030298-100 Anti-METAP1D Antibody, methionyl aminopeptidase type 1D (mitochondrial) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030298-25 Anti-METAP1D Antibody, methionyl aminopeptidase type 1D (mitochondrial) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: methionyl aminopeptidase type 1D (mitochondrial)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression
ICC (Immunocytochemistry)

Polyclonal antibody against Human METAP1D

항목	내용
Target Protein	methionyl aminopeptidase type 1D (mitochondrial)
Target Gene	METAP1D
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000041921 (96%), Rat ENSRNOG00000061587 (93%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand