
Atlas Antibodies Anti-MEIOC Antibody
상품 한눈에 보기
Human MEIOC 단백질을 인식하는 토끼 폴리클로날 항체로, 감수분열 특이 단백질 검출에 적합. IHC 기반 Orthogonal 검증 수행. PrEST 항원 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간, 마우스, 랫트 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MEIOC Antibody
meiosis specific with coiled-coil domain
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human MEIOC.
Alternative Gene Names
C17orf104, FLJ35848
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | meiosis specific with coiled-coil domain |
| Target Gene | MEIOC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000051455 (84%), Rat ENSRNOG00000021953 (82%) |
Antigen Sequence Detail:
YCQENPSAFSSFDFSYSGAERIQSVNHIEGLTKPGEENLFKLVTDKKIKQPNGFCDNYSAQKYGIIENVNKHNFQAKPQSGHYDPEEGPKHLDGLSQNTYQDLLESQGHSNSHRTRGGDNSRVNRTQVSCFSNN
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MEIS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MEIOB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MEIOC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MEGF8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MEGF9 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.