
원본
Atlas Antibodies Anti-MEIS1 Antibody
상품 한눈에 보기
Human MEIS1 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 실험에 적합하며, PrEST 항원으로 특이적 정제됨. 인간에 반응하며 마우스·랫과 높은 서열 유사성 보유. 안정적 PBS/glycerol 버퍼에 보존제 포함.
- 카탈로그번호
- HPA056000-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056000-100 Anti-MEIS1 Antibody, Meis homeobox 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056000-25 Anti-MEIS1 Antibody, Meis homeobox 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MEIS1 Antibody
Anti-MEIS1 Antibody
Target Information
- Protein: Meis homeobox 1
- Gene: MEIS1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000020160): 98%
- Rat (ENSRNOG00000004606): 95%
Product Description
Polyclonal antibody against human MEIS1.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



