Thermo Fisher Scientific DSPP Polyclonal Antibody
DSPP 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western blot 및 ELISA에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 고순도의 Affinity Chromatography 정제 항체입니다. -20°C 보관, 연구용 전용입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 1:500–1:2,000
ELISA
- Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16–146 of human DSPP (NP_055023.2) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.09 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.05% ProClin 300 |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2855074 |
Product Specific Information
Immunogen sequence:
IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNA
Target Information
This gene encodes two principal proteins of the dentin extracellular matrix of the tooth. The preproprotein is secreted by odontoblasts and cleaved into dentin sialoprotein and dentin phosphoprotein. Dentin phosphoprotein is thought to be involved in the biomineralization process of dentin. Mutations in this gene have been associated with dentinogenesis imperfecta-1; in some individuals, dentinogenesis imperfecta occurs in combination with an autosomal dominant form of deafness. Allelic differences due to repeat polymorphisms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific DRP2 Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific DTX2 Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific DSPP Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific DRG2 Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific DRD2 Polyclonal Antibody
627,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|