
Atlas Antibodies Anti-MDK Antibody
상품 한눈에 보기
Human MDK 단백질을 인식하는 Rabbit Polyclonal Antibody로, Affinity purification 방식으로 제조됨. 신경 성장 촉진 인자 연구에 적합하며, Human에 반응성이 검증됨. 다양한 응용 분야에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MDK Antibody
Target Information
- Protein: midkine (neurite growth-promoting factor 2)
- Gene: MDK
- Alternative Gene Names: FLJ27379, MK, NEGF2
Product Description
Polyclonal Antibody against Human MDK.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:DCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000017560 (93%)
- Mouse ENSMUSG00000027239 (93%)
Recommended Applications
ICC (Immunocytochemistry)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
