
원본
Atlas Antibodies Anti-MDK Antibody
상품 한눈에 보기
Human MDK 단백질을 인식하는 Rabbit Polyclonal Antibody로, Affinity purification 방식으로 제조됨. 신경 성장 촉진 인자 연구에 적합하며, Human에 반응성이 검증됨. 다양한 응용 분야에 사용 가능.
- 카탈로그번호
- HPA057126-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057126-100 Anti-MDK Antibody, midkine (neurite growth-promoting factor 2) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057126-25 Anti-MDK Antibody, midkine (neurite growth-promoting factor 2) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MDK Antibody
Anti-MDK Antibody
Target Information
- Protein: midkine (neurite growth-promoting factor 2)
- Gene: MDK
- Alternative Gene Names: FLJ27379, MK, NEGF2
Product Description
Polyclonal Antibody against Human MDK.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:DCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000017560 (93%)
- Mouse ENSMUSG00000027239 (93%)
Recommended Applications
ICC (Immunocytochemistry)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



