CacheBy
Atlas Antibodies Anti-MDK Antibody
원본

Atlas Antibodies Anti-MDK Antibody

상품 한눈에 보기

Human MDK 단백질을 인식하는 Rabbit Polyclonal Antibody로, Affinity purification 방식으로 제조됨. 신경 성장 촉진 인자 연구에 적합하며, Human에 반응성이 검증됨. 다양한 응용 분야에 사용 가능.

카탈로그번호
HPA057126-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057126-100 Anti-MDK Antibody, midkine (neurite growth-promoting factor 2) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057126-25 Anti-MDK Antibody, midkine (neurite growth-promoting factor 2) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MDK Antibody

Anti-MDK Antibody

Target Information

  • Protein: midkine (neurite growth-promoting factor 2)
  • Gene: MDK
  • Alternative Gene Names: FLJ27379, MK, NEGF2

Product Description

Polyclonal Antibody against Human MDK.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000017560 (93%)
  • Mouse ENSMUSG00000027239 (93%)

ICC (Immunocytochemistry)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.