
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MCM4 Antibody
상품 한눈에 보기
Human MCM4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 유전자 및 단백질 수준의 Orthogonal Validation 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. 다양한 종에서 높은 보존성 확인.
- 카탈로그번호
- HPA004873-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA004873-100 Anti-MCM4 Antibody, minichromosome maintenance complex component 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004873-25 Anti-MCM4 Antibody, minichromosome maintenance complex component 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MCM4 Antibody
Anti-MCM4 Antibody
Target: minichromosome maintenance complex component 4 (MCM4)
Type: Polyclonal Antibody against Human MCM4
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간 검증
- WB (Genetic Validation): siRNA knockdown을 통한 유전적 검증
- ICC: 세포 내 단백질 검출에 적합
Product Description
Polyclonal antibody raised in rabbit against human MCM4.
Validated for use in multiple applications with high specificity.
Alternative Gene Names
CDC21, CDC54, hCdc21, MGC33310, P1-Cdc21
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | minichromosome maintenance complex component 4 |
| Target Gene | MCM4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (96%), Rat (95%) |
Antigen Sequence:
LPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSAT
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



