CacheBy
Atlas Antibodies Anti-MCCC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCCC2 Antibody

상품 한눈에 보기

인체 MCCC2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 실험에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. 고순도의 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.

카탈로그번호
HPA038300-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038300-100 Anti-MCCC2 Antibody, methylcrotonoyl-CoA carboxylase 2 (beta) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038300-25 Anti-MCCC2 Antibody, methylcrotonoyl-CoA carboxylase 2 (beta) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCCC2 Antibody

Anti-MCCC2 Antibody

Target: methylcrotonoyl-CoA carboxylase 2 (beta)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human MCCC2.

Alternative Gene Names: MCCB
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit


Target Information

항목 내용
Target Protein methylcrotonoyl-CoA carboxylase 2 (beta)
Target Gene MCCC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADE
Verified Species Reactivity Human
Ortholog Identity Rat (ENSRNOG00000017752) – 90%, Mouse (ENSMUSG00000021646) – 90%

Buffer and Storage

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Storage Conditions Store according to supplier’s instructions
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.