
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MCCC2 Antibody
상품 한눈에 보기
인체 MCCC2 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 실험에 적합하며, RNA-seq 데이터 기반 직교 검증 완료. 고순도의 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공.
- 카탈로그번호
- HPA038300-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038300-100 Anti-MCCC2 Antibody, methylcrotonoyl-CoA carboxylase 2 (beta) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038300-25 Anti-MCCC2 Antibody, methylcrotonoyl-CoA carboxylase 2 (beta) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MCCC2 Antibody
Anti-MCCC2 Antibody
Target: methylcrotonoyl-CoA carboxylase 2 (beta)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human MCCC2.
Alternative Gene Names: MCCB
Clonality: Polyclonal
Isotype: IgG
Host: Rabbit
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methylcrotonoyl-CoA carboxylase 2 (beta) |
| Target Gene | MCCC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADE |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat (ENSRNOG00000017752) – 90%, Mouse (ENSMUSG00000021646) – 90% |
Buffer and Storage
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Storage Conditions | Store according to supplier’s instructions |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



