CacheBy
Atlas Antibodies Anti-MCF2L2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCF2L2 Antibody

상품 한눈에 보기

Human MCF2L2 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성 제공. IHC 등 다양한 응용에 적합. ARHGEF22, KIAA0861 대체 유전자명으로도 사용 가능.

카탈로그번호
HPA038947-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038947-100 Anti-MCF2L2 Antibody, MCF.2 cell line derived transforming sequence-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038947-25 Anti-MCF2L2 Antibody, MCF.2 cell line derived transforming sequence-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCF2L2 Antibody

Anti-MCF2L2 Antibody

Target: MCF.2 cell line derived transforming sequence-like 2
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)

Product Description

Polyclonal antibody against human MCF2L2.

Alternative Gene Names

  • ARHGEF22
  • KIAA0861

Open Datasheet

Target Information

항목 내용
Target Protein MCF.2 cell line derived transforming sequence-like 2
Target Gene MCF2L2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (30%), Rat (29%)

Antigen Sequence:
EMSTSKGSGAGSGPWIKNMERATTSKEDPASSTGGIKGCSSREFSSTDTFEDCEGAEDMEKESSALSLAGLFQSDDSHETCSSKSAFLERGESSQGE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.